HPA014063

MARCHF2 antibody from Atlas Antibodies
HSPC240, MARCH-II, MARCH2, RNF172
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014063
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014063, RRID:AB_1853576
Product name
Anti-MARCH2
Provider product page
Atlas Antibodies - HPA014063
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPL
AAGLLKKVAEETPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -