Antibody data

Product number
H00004296-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004296-M02, RRID:AB_1137291
Product name
MAP3K11 monoclonal antibody (M02), clone 3D11
Provider product page
Abnova Corporation - H00004296-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAP3K11.
Antigen sequence
PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSR
IDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSD
PFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEA
GP
Isotype
IgG
Antibody clone number
3D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -