HPA024334

GDAP1 antibody from Atlas Antibodies
CMT2K, CMT4, CMT4A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024334
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024334, RRID:AB_1849583
Product name
Anti-GDAP1
Provider product page
Atlas Antibodies - HPA024334
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILHPELTVDSMIPAYATTRIRSQIGNTESELKKLA
EENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILD
ELEKVLDQVETELQRRNEETPEEGQQPWLCGESFT
LADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYY
ERV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -