H00054332-A01

antibody from Abnova Corporation

Targeting: GDAP1 CMT2K, CMT4, CMT4A

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

H00054332-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00054332-A01, RRID:AB_535216

Product name

GDAP1 polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant GDAP1.

Antigen sequence

TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRL
KSKLLDHDNVKYLKKILDELEKVLDQVETELQRRN
EETPEEGQQPWLCGESFTLADVSLAVTLHR


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Silencing of the Charcot-Marie-Tooth disease-associated gene GDAP1 induces abnormal mitochondrial distribution and affects Ca2+ homeostasis by reducing store-operated Ca2+ entry.

Pla-Martín D, Rueda CB, Estela A, Sánchez-Piris M, González-Sánchez P, Traba J, de la Fuente S, Scorrano L, Renau-Piqueras J, Alvarez J, Satrústegui J, Palau F
Neurobiology of disease 2013 Jul;55:140-51

---

Charcot-Marie-Tooth-related gene GDAP1 complements cell cycle delay at G2/M phase in Saccharomyces cerevisiae fis1 gene-defective cells.

Estela A, Pla-Martín D, Sánchez-Piris M, Sesaki H, Palau F
The Journal of biological chemistry 2011 Oct 21;286(42):36777-86

---

Mitochondrial complex I deficiency in GDAP1-related autosomal dominant Charcot-Marie-Tooth disease (CMT2K).

Cassereau J, Chevrollier A, Gueguen N, Malinge MC, Letournel F, Nicolas G, Richard L, Ferre M, Verny C, Dubas F, Procaccio V, Amati-Bonneau P, Bonneau D, Reynier P
Neurogenetics 2009 Apr;10(2):145-50

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

GDAP1 polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of GDAP1 expression in HepG2 ( Cat # L019V1 ).