Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054332-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054332-A01, RRID:AB_535216
- Product name
- GDAP1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GDAP1.
- Antigen sequence
TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRL
KSKLLDHDNVKYLKKILDELEKVLDQVETELQRRN
EETPEEGQQPWLCGESFTLADVSLAVTLHR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Silencing of the Charcot-Marie-Tooth disease-associated gene GDAP1 induces abnormal mitochondrial distribution and affects Ca2+ homeostasis by reducing store-operated Ca2+ entry.
Charcot-Marie-Tooth-related gene GDAP1 complements cell cycle delay at G2/M phase in Saccharomyces cerevisiae fis1 gene-defective cells.
Mitochondrial complex I deficiency in GDAP1-related autosomal dominant Charcot-Marie-Tooth disease (CMT2K).
Pla-Martín D, Rueda CB, Estela A, Sánchez-Piris M, González-Sánchez P, Traba J, de la Fuente S, Scorrano L, Renau-Piqueras J, Alvarez J, Satrústegui J, Palau F
Neurobiology of disease 2013 Jul;55:140-51
Neurobiology of disease 2013 Jul;55:140-51
Charcot-Marie-Tooth-related gene GDAP1 complements cell cycle delay at G2/M phase in Saccharomyces cerevisiae fis1 gene-defective cells.
Estela A, Pla-Martín D, Sánchez-Piris M, Sesaki H, Palau F
The Journal of biological chemistry 2011 Oct 21;286(42):36777-86
The Journal of biological chemistry 2011 Oct 21;286(42):36777-86
Mitochondrial complex I deficiency in GDAP1-related autosomal dominant Charcot-Marie-Tooth disease (CMT2K).
Cassereau J, Chevrollier A, Gueguen N, Malinge MC, Letournel F, Nicolas G, Richard L, Ferre M, Verny C, Dubas F, Procaccio V, Amati-Bonneau P, Bonneau D, Reynier P
Neurogenetics 2009 Apr;10(2):145-50
Neurogenetics 2009 Apr;10(2):145-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GDAP1 polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of GDAP1 expression in HepG2 ( Cat # L019V1 ).