HPA014266

GDAP1 antibody from Sigma-Aldrich
CMT2K, CMT4, CMT4A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014266
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014266, RRID:AB_1849581
Product name
Anti-GDAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014266
Antibody type
Polyclonal
Antigen
Ganglioside-induced differentiation-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQI
IDYLEQTFLDERTPRLMPDKESMYY
Storage
-20C
Provider Type Product Number
- No reagents -