ABIN406457

NOB1 antibody from antibodies-online
ART-4, MST158, NOB1P, PSMD8BP1

Antibody data

Product number
ABIN406457
Provider
antibodies-online
Product name
anti-RNA-Binding Protein NOB1 (NOB1) (N-Term) antibody
Provider product page
antibodies-online - ABIN406457
Antibody type
Polyclonal
Antigen
The immunogen for anti-NOB1 antibody: synthetic peptide directed towards the N terminal of human NOB1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEF
SKKTG DYPSLSATDI
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -