Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406457 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-RNA-Binding Protein NOB1 (NOB1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NOB1 antibody: synthetic peptide directed towards the N terminal of human NOB1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
- TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEF
 SKKTG DYPSLSATDI
- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references		Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
				
		
	
			Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
		Cell 2006 Nov 3;127(3):635-48
				No comments: Submit comment	
	
			
			No validations: Submit validation data