SAB2101613

NOB1 antibody from MilliporeSigma / Merck KGaA
ART-4, MST158, NOB1P, PSMD8BP1
No application information provided.

Antibody data

Product number
SAB2101613
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2101613, RRID:AB_10605516
Product name
Anti-NOB1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101613
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_054781.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSLPTPKGGKYAINPHLTEDQRFPQLRLSQKARQK
TNVFAPDYIAGVSPF
Storage
-20C
Provider Type Product Number
- No reagents -