H00006494-M01A

SIPA1 antibody from Abnova Corporation
SPA1
No application information provided.

Antibody data

Product number
H00006494-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006494-M01A, RRID:AB_1204979
Product name
SIPA1 monoclonal antibody (M01A), clone 2B4
Provider product page
Abnova Corporation - H00006494-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SIPA1.
Antigen sequence
SEIASTCNTILESLSREGQPIPESGDPKGTPKSDA
EPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAAL
EEEVRSLRHNNRRLQAESESAATRLLLASKQLGSP
TADLA
Isotype
IgG
Antibody clone number
2B4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -