HPA043918

CEP290 antibody from Atlas Antibodies
3H11Ag, BBS14, CT87, FLJ13615, JBTS5, KIAA0373, LCA10, MKS4, NPHP6, POC3, rd16, SLSN6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA043918
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043918, RRID:AB_2678730
Product name
Anti-CEP290
Provider product page
Atlas Antibodies - HPA043918
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QVESINKELEITKEKLHTIEQAWEQETKLGNESSM
DKAKKSITNSDIVSISKKITMLEMKELNERQRAEH
CQKMYEHLRTSLKQMEERNFELETKFAELT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -