HPA064397

CEP290 antibody from Atlas Antibodies
3H11Ag, BBS14, CT87, FLJ13615, JBTS5, KIAA0373, LCA10, MKS4, NPHP6, POC3, rd16, SLSN6

Antibody data

Product number
HPA064397
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA064397, RRID:AB_2685255
Product name
Anti-CEP290
Provider product page
Atlas Antibodies - HPA064397
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLT
GRNEELRQELRESRKEAINYSQQLAKANLKIDHLE
KETSLLRQSEGSNVVFKGIDLPDGIAPSSASII
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -