Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005004-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005004-M01, RRID:AB_425575
- Product name
- ORM1 monoclonal antibody (M01), clone 2F9-1F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ORM1.
- Antigen sequence
AQIPLCANLVPVPITNATLDRITGKWFYIASAFRN
EEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQ
DQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLIL
RDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLG
EFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEK
ERKQEEGES- Isotype
- IgG
- Antibody clone number
- 2F9-1F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A serum protein profile predictive of the resistance to neoadjuvant chemotherapy in advanced breast cancers.
Hyung SW, Lee MY, Yu JH, Shin B, Jung HJ, Park JM, Han W, Lee KM, Moon HG, Zhang H, Aebersold R, Hwang D, Lee SW, Yu MH, Noh DY
Molecular & cellular proteomics : MCP 2011 Oct;10(10):M111.011023
Molecular & cellular proteomics : MCP 2011 Oct;10(10):M111.011023
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ORM1 monoclonal antibody (M01), clone 2F9-1F10 Western Blot analysis of ORM1 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ORM1 expression in transfected 293T cell line by ORM1 monoclonal antibody (M01), clone 2F9-1F10.Lane 1: ORM1 transfected lysate(23.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ORM1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ORM1 transfected lysate using anti-ORM1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ORM1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ORM1 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol