HPA014319

MEGF9 antibody from MilliporeSigma / Merck KGaA
EGFL5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014319
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014319, RRID:AB_1848035
Product name
Anti-MEGF9 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014319
Antibody type
Polyclonal
Antigen
Multiple epidermal growth factor-like domains 9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVS
GLLEDDGNEVAPNGQLTLT
Storage
-20C
Provider Type Product Number
- No reagents -