HPA014319

antibody from Atlas Antibodies

Targeting: MEGF9 EGFL5

Antibody data

Submit

Validation data

Product number: HPA014319 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA014319, RRID:AB_1848035
Product name: Anti-MEGF9
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVS GLLEDDGNEVAPNGQLTLT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MEGF9 protein structure - HPA014319 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong cytoplasmic/ membranous positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Sample type: HUMAN