HPA014499

RNF130 antibody from Sigma-Aldrich
G1RZFP, GOLIATH, GP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014499, RRID:AB_1856328
Product name
Anti-RNF130 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014499
Antibody type
Polyclonal
Antigen
Goliath homolog precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PWLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFD
MERLTRTQAVNRRSA
Storage
-20C
Provider Type Product Number
- No reagents -