Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010736-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010736-M01, RRID:AB_436993
- Product name
- SIX2 monoclonal antibody (M01), clone 3D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SIX2.
- Antigen sequence
MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLW
SLPACEHLHKNESVLKAKAVVAFHRGNFRELYKIL
ESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGA
VGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLR
EWYAHNPYPSPREKRELTEATGLTTTQVSNWFKNR
RQRDRAAEAKERENNENSNSNSHNPLNGSGKSVLG
SSEDEKTPSGTPDHSSSSPALLLSPPPPGLPSLHS
LGHPPGPSAVPVPVPGGGGADPLQHHHGLQDSILN
PMSANLVDLGS- Isotype
- IgG
- Antibody clone number
- 3D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ROBO2 restricts the nephrogenic field and regulates Wolffian duct-nephrogenic cord separation.
Fat4/Dchs1 signaling between stromal and cap mesenchyme cells influences nephrogenesis and ureteric bud branching.
Mdm2 is required for maintenance of the nephrogenic niche.
Transcription coactivator Eya2 is a critical regulator of physiological hypertrophy.
SIX2 and CITED1, markers of nephronic progenitor self-renewal, remain active in primitive elements of Wilms' tumor.
Wainwright EN, Wilhelm D, Combes AN, Little MH, Koopman P
Developmental biology 2015 Aug 15;404(2):88-102
Developmental biology 2015 Aug 15;404(2):88-102
Fat4/Dchs1 signaling between stromal and cap mesenchyme cells influences nephrogenesis and ureteric bud branching.
Mao Y, Francis-West P, Irvine KD
Development (Cambridge, England) 2015 Aug 1;142(15):2574-85
Development (Cambridge, England) 2015 Aug 1;142(15):2574-85
Mdm2 is required for maintenance of the nephrogenic niche.
Hilliard SA, Yao X, El-Dahr SS
Developmental biology 2014 Mar 1;387(1):1-14
Developmental biology 2014 Mar 1;387(1):1-14
Transcription coactivator Eya2 is a critical regulator of physiological hypertrophy.
Lee SH, Kim J, Ryu JY, Lee S, Yang DK, Jeong D, Kim J, Lee SH, Kim JM, Hajjar RJ, Park WJ
Journal of molecular and cellular cardiology 2012 Mar;52(3):718-26
Journal of molecular and cellular cardiology 2012 Mar;52(3):718-26
SIX2 and CITED1, markers of nephronic progenitor self-renewal, remain active in primitive elements of Wilms' tumor.
Murphy AJ, Pierce J, de Caestecker C, Taylor C, Anderson JR, Perantoni AO, de Caestecker MP, Lovvorn HN 3rd
Journal of pediatric surgery 2012 Jun;47(6):1239-49
Journal of pediatric surgery 2012 Jun;47(6):1239-49
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SIX2 expression in transfected 293T cell line by SIX2 monoclonal antibody (M01), clone 3D7.Lane 1: SIX2 transfected lysate(32.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SIX2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol