HPA030567

SRBD1 antibody from MilliporeSigma / Merck KGaA
FLJ10379
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030567
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030567, RRID:AB_10611244
Product name
Anti-SRBD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030567
Antibody type
Polyclonal
Antigen
S1 RNA binding domain 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDQTCIHPESYDIAMRFLSSIGGTLYEVGKPEMQQ
KINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQP
ESFDFRTDFDKPDF
Storage
-20C
Provider Type Product Number
- No reagents -