HPA014545

CLCN2 antibody from Sigma-Aldrich
ClC-2, CLC2, EJM6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014545, RRID:AB_1846881
Product name
Anti-CLCN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014545
Antibody type
Polyclonal
Antigen
Chloride channel protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGV
KVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG
Storage
-20C
Provider Type Product Number
- No reagents -