H00010882-B01

C1QL1 antibody from Abnova Corporation
C1QRF, C1QTNF14, CRF, CTRP14

Antibody data

Product number
H00010882-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010882-B01, RRID:AB_1137848
Product name
C1QL1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00010882-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C1QL1 protein.
Antigen sequence
MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPY
PARGPGAGARTDGGDALSEQSGAPPPSTLVQGPQG
KPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKP
GPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPH
EGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYF
FTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDAD
QNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSN
KYSTFSGFIIYSD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -