PAB28007

ZNF512B antibody from Abnova Corporation
GM632, MGC149845, MGC149846

Antibody data

Product number
PAB28007
Provider
Abnova Corporation
Product name
ZNF512B polyclonal antibody
Provider product page
Abnova Corporation - PAB28007
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF512B
Antigen sequence
FPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPG
PISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKP
IGISKPVSVGRPMPVTKAIPVTRPVPVTKPVTVSR
PMPVTKAMPVTKPITVTKSVPVTKPVPVT
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -