ABIN404857

ZNF512B antibody from antibodies-online
GM632, MGC149845, MGC149846

Antibody data

Product number
ABIN404857
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 512B (ZNF512B) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404857
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF512B antibody: synthetic peptide directed towards the middle region of human ZNF512B
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
ALKCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEAS
EGGEQ EERERLRKVL
Epitope
Middle Region
Vial size (┬Ál)
50 μg
Concentration (mg/ml)
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -