ABIN404857

ZNF512B antibody from antibodies-online
GM632, MGC149845, MGC149846

Antibody data

Product number
ABIN404857
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 512B (ZNF512B) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404857
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF512B antibody: synthetic peptide directed towards the middle region of human ZNF512B
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
ALKCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEAS
EGGEQ EERERLRKVL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -