Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056126-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056126-M07, RRID:AB_606736
- Product name
- PCDHB10 monoclonal antibody (M07), clone 4C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCDHB10.
- Antigen sequence
GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAA
RGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLC
GPKEPCMLYFQILMDDPFQIYRAELRVRD- Isotype
- IgG
- Antibody clone number
- 4C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Gene expression profiling-based identification of cell-surface targets for developing multimeric ligands in pancreatic cancer.
Balagurunathan Y, Morse DL, Hostetter G, Shanmugam V, Stafford P, Shack S, Pearson J, Trissal M, Demeure MJ, Von Hoff DD, Hruby VJ, Gillies RJ, Han H
Molecular cancer therapeutics 2008 Sep;7(9):3071-80
Molecular cancer therapeutics 2008 Sep;7(9):3071-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCDHB10 monoclonal antibody (M07), clone 4C4 Western Blot analysis of PCDHB10 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PCDHB10 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol