HPA013445

PCDHB10 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013445
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013445, RRID:AB_1855054
Product name
Anti-PCDHB10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013445
Antibody type
Polyclonal
Antigen
Protocadherin beta-10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDS
HTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPF
QIYRAELRVRDINDHAPVFQDKETVLKISENTAEG
TAFRLERAQDPDGGLNGIQNYTISPNSF
Storage
-20C
Provider Type Product Number
- No reagents -