HPA013447

SNX19 antibody from Sigma-Aldrich
CHET8, KIAA0254
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013447
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013447, RRID:AB_1857347
Product name
Anti-SNX19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013447
Antibody type
Polyclonal
Antigen
Sorting nexin-19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVEARKSLLESFLKQLCAIPEIANSEEVQEFLALN
TDARIAFVKKPFMVSRIDKMVVSAIVDTLKTAFPR
SEPQSPTEELSEAETESKPQTEGKKASKSRLRFSS
SKISPALSVTEAQDKILYCLQ
Storage
-20C
Provider Type Product Number
- No reagents -