H00002034-M08

EPAS1 antibody from Abnova Corporation
bHLHe73, HIF2A, HLF, MOP2, PASD2

Antibody data

Product number
H00002034-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002034-M08, RRID:AB_10901799
Product name
EPAS1 monoclonal antibody (M08), clone 1G2
Provider product page
Abnova Corporation - H00002034-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EPAS1.
Antigen sequence
SKETEVFYELAHELPLPHSVSSHLDKASIMRLAIS
FLRTHKLLSSVCSENESEAEADQQMDNLYLKALEG
FIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIF
DFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERD
FFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVY
NNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDI
PLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEEL
LGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQY
RMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNY
VLSEI
Isotype
IgG
Antibody clone number
1G2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -