HPA014722

KCNJ5 antibody from Sigma-Aldrich
CIR, GIRK4, KATP1, Kir3.4, LQT13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014722
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014722, RRID:AB_1852133
Product name
Anti-KCNJ5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014722
Antibody type
Polyclonal
Antigen
G protein-activated inward rectifier potassium channel 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELA
EMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEE
DEPKGLGG
Storage
-20C
Provider Type Product Number
- No reagents -