Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406082 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACBD4 antibody: synthetic peptide directed towards the N terminal of human ACBD4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPS
YEEML RFYSYYKQAT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
Yamada S, Ohira M, Horie H, Ando K, Takayasu H, Suzuki Y, Sugano S, Hirata T, Goto T, Matsunaga T, Hiyama E, Hayashi Y, Ando H, Suita S, Kaneko M, Sasaki F, Hashizume K, Ohnuma N, Nakagawara A
Oncogene 2004 Aug 5;23(35):5901-11
Oncogene 2004 Aug 5;23(35):5901-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting