Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1105203 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N terminal of human ACBD4
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPS
YEEMLRFYSYYKQAT- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
Yamada S, Ohira M, Horie H, Ando K, Takayasu H, Suzuki Y, Sugano S, Hirata T, Goto T, Matsunaga T, Hiyama E, Hayashi Y, Ando H, Suita S, Kaneko M, Sasaki F, Hashizume K, Ohnuma N, Nakagawara A
Oncogene 2004 Aug 5;23(35):5901-11
Oncogene 2004 Aug 5;23(35):5901-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Transfected 293T; WB Suggested Anti-ACBD4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Transfected 293T; ACBD4 antibody - N-terminal region (AP44869PU-N) in Transfected 293T cells using Western Blot