HPA017636

SLITRK3 antibody from Sigma-Aldrich
KIAA0848
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017636
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017636, RRID:AB_1857232
Product name
Anti-SLITRK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017636
Antibody type
Polyclonal
Antigen
SLIT and NTRK-like protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQWIE
TISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPE
MLHVAPAGESPAQPGDSHLIGAPTSASP
Storage
-20C
Provider Type Product Number
- No reagents -