Antibody data

Product number
H00222643-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00222643-M03, RRID:AB_1237898
Product name
UNC5CL monoclonal antibody (M03), clone 3G7
Provider product page
Abnova Corporation - H00222643-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant UNC5CL.
Antigen sequence
MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHC
PRRLLGACWTLNGQEEPVSQPTPQLENEVSRQHLP
ATLPEMVAFYQELHTPTQGQTMVRQLMHKLLVFSA
REVDHRGGCLMLQDTGISLLIPPGAVAVGRQERVS
LILVWDLSDAPSLSQAQGLVSPVVACGPHGASFLK
PCTLTFKHCAEQPSHARTYSSNTTLLDAKVWRPLG
RPGAHASRDECRIHLSHFSLYTCVLEAPVGREARK
WLQLAVFCSPLVPGQSHLQLRIYFLNNTPCALQWA
LTNEQPHGGRLRGPCQLFDFNGARGDQCLKLTYIS
EGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKA
ADENEDCSALTNEIIVTMHTFQDGLETKYMEILRF
QASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLL
EPNSITGNDWRGLASHLGLCGMKIRFLSCQRSPAA
AILELFEEQNGSLQELHYLMTVMERLDCASAIQNY
LSGTHGGSPGPERGGARDNQGLELDEKL
Isotype
IgG
Antibody clone number
3G7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -