PAB19991

RNASE6 antibody from Abnova Corporation
RAD1, RNaseK6, RNS6

Antibody data

Product number
PAB19991
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19991, RRID:AB_10963850
Product name
RNASE6 polyclonal antibody
Provider product page
Abnova Corporation - PAB19991
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RNASE6.
Antigen sequence
PKRITKAHWFEIQHIQPSPLQCNRAMSGINNYTQH
CKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQ
SSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVAC
DPPQKSDPPYKLVPV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -