HPA000698

RNASE6 antibody from Sigma-Aldrich
RAD1, RNS6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000698
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000698, RRID:AB_2181340
Product name
Anti-RNASE6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000698
Antibody type
Polyclonal
Antigen
Ribonuclease K6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKRITKAHWFEIQHIQPSPLQCNRAMSGINNYTQH
CKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQ
SSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVAC
DPPQKSDPPYKLVPV
Storage
-20C
Provider Type Product Number
- No reagents -