Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406293 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Prostaglandin Reductase 2 (PTGR2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZADH1 antibody: synthetic peptide directed towards the middle region of human ZADH1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLI
GIQEK GHITAGSNKT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of a novel prostaglandin reductase reveals the involvement of prostaglandin E2 catabolism in regulation of peroxisome proliferator-activated receptor gamma activation.
Chou WL, Chuang LM, Chou CC, Wang AH, Lawson JA, FitzGerald GA, Chang ZF
The Journal of biological chemistry 2007 Jun 22;282(25):18162-72
The Journal of biological chemistry 2007 Jun 22;282(25):18162-72
No comments: Submit comment
No validations: Submit validation data