HPA000695

PTGR2 antibody from Sigma-Aldrich
FLJ39091, ZADH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000695
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000695, RRID:AB_1080628
Product name
Anti-ZADH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000695
Antibody type
Polyclonal
Antigen
Prostaglandin reductase 2 (PRG-2) (15-oxoprostaglandin 13-reductase) (Zinc-binding alcohol dehydrogenase domain-containing protein 1)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAGKIGHFLGCSRVVGICGTHEKCILLTSELGFDA
AINYKKDNVAEQLRESCPAGVDVYFDNVGGNISDT
VISQMNENSHIILCGQISQYNKDVPYPPPLSPAIE
AIQKERNITRERFLVLNYKDKFEPGILQLSQWFKE
Storage
-20C
Provider Type Product Number
- No reagents -