HPA004149

MCHR1 antibody from Sigma-Aldrich
GPR24, MCH1R, SLC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004149
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004149, RRID:AB_1079363
Product name
Anti-MCHR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004149
Antibody type
Polyclonal
Antigen
Melanin-concentrating hormone receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACA
PGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDL
EASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISY
INIIMP
Storage
-20C
Provider Type Product Number
- No reagents -