HPA015968

ERGIC3 antibody from Sigma-Aldrich
C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015968
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015968, RRID:AB_1848239
Product name
Anti-ERGIC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015968
Antibody type
Polyclonal
Antigen
Endoplasmic reticulum-Golgi intermediate compartment protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQAS
MMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKV
ANGLLGDQGLPGVFVLYELSPMMVKLTEKH
Storage
-20C
Provider Type Product Number
- No reagents -