HPA015242

ERGIC3 antibody from Atlas Antibodies
C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015242
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015242, RRID:AB_1848238
Product name
Anti-ERGIC3
Provider product page
Atlas Antibodies - HPA015242
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQK
MQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQS
HVH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -