HPA021558

PLEKHM1 antibody from Sigma-Aldrich
KIAA0356
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021558
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021558, RRID:AB_1855464
Product name
Anti-PLEKHM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021558
Antibody type
Polyclonal
Antigen
Pleckstrin homology domain-containing family M member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPVESTSGQQPSSTVSETAREVGQGNGLQKAQAHD
GAGLKLVVSSPTSPKNKSWISEDDFYRPSREQPLE
SASDHPIASYRGTPGSR
Storage
-20C
Provider Type Product Number
- No reagents -