HPA031190

SART1 antibody from MilliporeSigma / Merck KGaA
Ara1, HAF, SNRNP110, Snu66
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031190
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031190, RRID:AB_10602289
Product name
Anti-SART1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031190
Antibody type
Polyclonal
Antigen
squamous cell carcinoma antigen recognized by T cells recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQ
KVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEY
RGFTQDFKEKDGYKPDVK
Storage
-20C
Provider Type Product Number
- No reagents -