Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182934 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 112 (RNF112) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the C terminal of human ZNF179
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRF
CGHLA AVGGAVGAGL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Death is associated with complement C3 depletion in cerebrospinal fluid of patients with pneumococcal meningitis.
cDNA cloning of a human brain finger protein, BFP/ZNF179, a member of the RING finger protein family.
Goonetilleke UR, Scarborough M, Ward SA, Hussain S, Kadioglu A, Gordon SB
mBio 2012;3(2)
mBio 2012;3(2)
cDNA cloning of a human brain finger protein, BFP/ZNF179, a member of the RING finger protein family.
Seki N, Hattori A, Muramatsu M, Saito T
DNA research : an international journal for rapid publication of reports on genes and genomes 1999 Oct 29;6(5):353-6
DNA research : an international journal for rapid publication of reports on genes and genomes 1999 Oct 29;6(5):353-6
No comments: Submit comment
No validations: Submit validation data