Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109564 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 112 (RNF112) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the C terminal of human ZNF179
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRF
CGHLAAVGGAVGAGL- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references cDNA cloning of a human brain finger protein, BFP/ZNF179, a member of the RING finger protein family.
Seki N, Hattori A, Muramatsu M, Saito T
DNA research : an international journal for rapid publication of reports on genes and genomes 1999 Oct 29;6(5):353-6
DNA research : an international journal for rapid publication of reports on genes and genomes 1999 Oct 29;6(5):353-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HepG2; WB Suggested Anti-ZNF179 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate; ZNF179 antibody - C-terminal region (AP42257PU-N) in Human HepG2 cells using Western Blot