HPA015970

RNF112 antibody from Sigma-Aldrich
BFP, ZNF179
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015970
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015970, RRID:AB_1859103
Product name
Anti-RNF112 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015970
Antibody type
Polyclonal
Antigen
RING finger protein 112 (Zinc finger protein 179) (Brain finger protein)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKV
EAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNL
LSTQKDAILARHGVALLCKGRDQTLEALEAELQAT
AKAFMDSYT
Storage
-20C
Provider Type Product Number
- No reagents -