HPA013835

CRB3 antibody from Sigma-Aldrich
MGC17303
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013835
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013835, RRID:AB_1847214
Product name
Anti-CRB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013835
Antibody type
Polyclonal
Antigen
Crumbs protein homolog 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSK
ETVQGCLPI
Storage
-20C
Provider Type Product Number
- No reagents -