AV49878

TREML2 antibody from MilliporeSigma / Merck KGaA
C6orf76, dJ238O23.1, FLJ13693, TLT2
No application information provided.

Antibody data

Product number
AV49878
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-TREML2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV49878
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human TREML2 with an internal ID of Y02742
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASTRPASKTGYSFTATSTTSQGPRRTMGSQTVTAS
PSNARDSSAGPESIS
Storage
-20C