HPA015870

PTPRE antibody from Sigma-Aldrich
PTPE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015870
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015870, RRID:AB_1855759
Product name
Anti-PTPRE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015870
Antibody type
Polyclonal
Antigen
Receptor-type tyrosine-protein phosphatase epsilon precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEE
EIRIRSADDCKQFREEFNSLPSGHIQGTFELANKE
ENREKNRYPNILPNDHSRVILSQLDGIPCSDYINA
SYIDGYKEKNKFIAAQGPKQE
Storage
-20C
Provider Type Product Number
- No reagents -