Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008815-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008815-M01, RRID:AB_425785
- Product name
- BANF1 monoclonal antibody (M01), clone 3F10-4G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant BANF1.
- Antigen sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLE
ERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN
AKQSRDCFGCLREWCDAFL- Isotype
- IgG
- Antibody clone number
- 3F10-4G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dephosphorylation of barrier-to-autointegration factor by protein phosphatase 4 and its role in cell mitosis.
Zhuang X, Semenova E, Maric D, Craigie R
The Journal of biological chemistry 2014 Jan 10;289(2):1119-27
The Journal of biological chemistry 2014 Jan 10;289(2):1119-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BANF1 monoclonal antibody (M01), clone 3F10-4G12 Western Blot analysis of BANF1 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BANF1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to BANF1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol