Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00094240-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00094240-M01, RRID:AB_534858
- Product name
- EPSTI1 monoclonal antibody (M01), clone 2A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
- Antigen sequence
MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELS
PVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLI
APNINRRNEIQRIAEQELANLEKWKEQNRA- Isotype
- IgG
- Antibody clone number
- 2A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EPSTI1 monoclonal antibody (M01), clone 2A8 Western Blot analysis of EPSTI1 expression in A-431( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EPSTI1 expression in transfected 293T cell line by EPSTI1 monoclonal antibody (M01), clone 2A8.Lane 1: EPSTI1 transfected lysate(36.793 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EPSTI1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to EPSTI1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
