Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00094240-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00094240-M02, RRID:AB_1112635
- Product name
- EPSTI1 monoclonal antibody (M02), clone 3G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
- Antigen sequence
MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELS
PVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLI
APNINRRNEIQRIAEQELANLEKWKEQNRA- Isotype
- IgG
- Antibody clone number
- 3G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cigarette smoke modulates expression of human rhinovirus-induced airway epithelial host defense genes.
Epithelial-stromal interaction 1 (EPSTI1) substitutes for peritumoral fibroblasts in the tumor microenvironment.
Proud D, Hudy MH, Wiehler S, Zaheer RS, Amin MA, Pelikan JB, Tacon CE, Tonsaker TO, Walker BL, Kooi C, Traves SL, Leigh R
PloS one 2012;7(7):e40762
PloS one 2012;7(7):e40762
Epithelial-stromal interaction 1 (EPSTI1) substitutes for peritumoral fibroblasts in the tumor microenvironment.
de Neergaard M, Kim J, Villadsen R, Fridriksdottir AJ, Rank F, Timmermans-Wielenga V, Langerød A, Børresen-Dale AL, Petersen OW, Rønnov-Jessen L
The American journal of pathology 2010 Mar;176(3):1229-40
The American journal of pathology 2010 Mar;176(3):1229-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EPSTI1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol