HPA017362

EPSTI1 antibody from Sigma-Aldrich
BRESI1, MGC29634
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017362
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017362, RRID:AB_1848226
Product name
Anti-EPSTI1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017362
Antibody type
Polyclonal
Antigen
Epithelial-stromal interaction protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELK
RQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGG
LEQSGGCWNMNSGNSW
Storage
-20C
Provider Type Product Number
- No reagents -