Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035820 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CDK5RAP2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNL
TYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQ
DNETEKTSVMV- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Clinical and cellular features in patients with primary autosomal recessive microcephaly and a novel CDK5RAP2 mutation
Abnormal centrosome and spindle morphology in a patient with autosomal recessive primary microcephaly type 2 due to compound heterozygous WDR62 gene mutation
Issa L, Mueller K, Seufert K, Kraemer N, Rosenkotter H, Ninnemann O, Buob M, Kaindl A, Morris-Rosendahl D
Orphanet Journal of Rare Diseases 2013;8(1)
Orphanet Journal of Rare Diseases 2013;8(1)
Abnormal centrosome and spindle morphology in a patient with autosomal recessive primary microcephaly type 2 due to compound heterozygous WDR62 gene mutation
Farag H, Froehler S, Oexle K, Ravindran E, Schindler D, Staab T, Huebner A, Kraemer N, Chen W, Kaindl A
Orphanet Journal of Rare Diseases 2013;8(1)
Orphanet Journal of Rare Diseases 2013;8(1)
No comments: Submit comment
No validations: Submit validation data