Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [4]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91163 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91163, RRID:AB_2665827
- Product name
- Anti-CDK5RAP2
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNL
TYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQ
DNETEKTSVMV- Epitope
- Binds to an epitope located within the peptide sequence YETSEKSFFS as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3392
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of HeLa cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of A431 cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of U2OS cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of U251 cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows centrosome-like immunoreactivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows centrosome-like positivity in lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows centrosome-like immunoreactivity in a subset of seminiferous epithelium cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows centrosome-like positivity in renal cells.